PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10008150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 249aa    MW: 27370.3 Da    PI: 5.3715
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10008150genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.22.4e-10156214563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l++e+
  Lus10008150 156 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAEN 214
                  9*********************************************9998888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-16152216IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.932154217IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.99E-11156207No hitNo description
Gene3DG3DSA:1.20.5.1706.2E-9156210No hitNo description
PfamPF001706.5E-9156204IPR004827Basic-leucine zipper domain
CDDcd147039.63E-24157206No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MSDNPPKNMG HRRAHSEILT LPDDISFGSD LGVVGADGPS FSDDTEEDIL SVYLNMEKLN  60
SSSSATSGFQ IGESSNHLLS SADNNWTGSS APMMLDSASA PTERPRVRHQ HSQSMDGSTS  120
IKSEMLMSAS EDASDVDSKK AISAAKLAEL ALVDPKRAKR IWANRQSAAR SKERKMRYIA  180
ELERKVQTLQ TEATSLSAQL TLLQRDTNGL TAENSELKLR LQTTEQQVHL QDGNCRVYFL  240
EEYSTHFF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012065205.11e-124PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-109POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A067LI271e-124A0A067LI27_JATCU; Uncharacterized protein
STRINGPOPTR_0017s05610.11e-123(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55173249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-120bZIP family protein